PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g076460.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 303aa    MW: 34157.4 Da    PI: 7.1606
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g076460.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33e-3262115255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          rlrWtp+LH+rFv+ave+LGG+++AtPk +l+lm++kgL ++hvkSHLQ+YR+
  Sopim10g076460.0.1  62 VRLRWTPDLHRRFVHAVERLGGHDRATPKLVLQLMNIKGLNIAHVKSHLQMYRS 115
                         59***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.71458118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-3058116IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-2263117IPR006447Myb domain, plants
SuperFamilySSF466896.27E-1563116IPR009057Homeodomain-like
PfamPF002499.2E-963114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MMEDSGDTEF SKTSPNSNQN EEEDENVTST KLHKDGGSSS ISTIEESEKK FSVRPYVRSK  60
MVRLRWTPDL HRRFVHAVER LGGHDRATPK LVLQLMNIKG LNIAHVKSHL QMYRSKKIDD  120
PSQGITNHHK LCMEGGDSYI YNLSQLPMLS SFKQRFNPTF RYGDVSSMNC QDHDLMHSSI  180
MGQSTIDKAR IGLYTTLNER IFGSNPIDKL TPLFQIAEKS QARILSTPLK RKAMDCDLID  240
LNLSLGVKQK HNSHDNDDDD DDGSTLTLSL SSQRSPSRLK EDVNYAIIED ARRGASTLDL  300
TL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2401970.0AC240197.3 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-208l2 map 10, complete sequence.
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249715.10.0PREDICTED: uncharacterized protein LOC101244920
TrEMBLK4D1Y80.0K4D1Y8_SOLLC; Uncharacterized protein
STRINGSolyc10g076460.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-50G2-like family protein